PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.2NG419400.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family MIKC_MADS
Protein Properties Length: 242aa    MW: 27865.7 Da    PI: 9.6062
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.2NG419400.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF99.81e-31959151
                         S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
               SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                         krienk+nrqvtf+kRrng+lKKA+ELSvLCdaeva+iifs++gklye++s
  Pavir.2NG419400.2.p  9 KRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCS 59
                         79***********************************************96 PP

2K-box98.21.2e-32851769100
                K-box   9 leeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkl 98 
                          +e++  +s+++e+ kLk+++enLqr+qR+llGedL++L +keL+qLe+qL++sl++iRs++++++l+q+++lq++e++l e+nk+Lr+kl
  Pavir.2NG419400.2.p  85 KENELVQSSRNEYLKLKARVENLQRTQRNLLGEDLGTLGIKELEQLEKQLDSSLRHIRSTRTQHMLDQLNDLQRREHMLCEANKCLRRKL 174
                          46667899*********************************************************************************9 PP

                K-box  99 ee 100
                          ee
  Pavir.2NG419400.2.p 175 EE 176
                          87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.4E-40160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006633.137161IPR002100Transcription factor, MADS-box
CDDcd002651.64E-43277No hitNo description
SuperFamilySSF554557.59E-33288IPR002100Transcription factor, MADS-box
PRINTSPR004048.5E-33323IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003192.2E-261057IPR002100Transcription factor, MADS-box
PRINTSPR004048.5E-332338IPR002100Transcription factor, MADS-box
PRINTSPR004048.5E-333859IPR002100Transcription factor, MADS-box
PfamPF014864.2E-2687174IPR002487Transcription factor, K-box
PROSITE profilePS5129715.42690180IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 242 aa     Download sequence    Send to blast
MGRGRVELKR IENKINRQVT FAKRRNGLLK KAYELSVLCD AEVALIIFSN RGKLYEFCSG  60
QSITKTLERY QKSSYGGPDT AIQNKENELV QSSRNEYLKL KARVENLQRT QRNLLGEDLG  120
TLGIKELEQL EKQLDSSLRH IRSTRTQHML DQLNDLQRRE HMLCEANKCL RRKLEETSSQ  180
VHGQVWEHGG NLLGYERQSP QQGPSHVRNG FFHPLEVAPE PTLQIGFAPE HMNNFMPTWL  240
P*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ox0_A5e-34751761103Developmental protein SEPALLATA 3
4ox0_B5e-34751761103Developmental protein SEPALLATA 3
4ox0_C5e-34751761103Developmental protein SEPALLATA 3
4ox0_D5e-34751761103Developmental protein SEPALLATA 3
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAJ4306940.0AJ430694.1 Zea mays mRNA for putative MADS-domain transcription factor (m27 gene).
GenBankBT0333980.0BT033398.1 Zea mays full-length cDNA clone ZM_BFb0100K01 mRNA, complete cds.
GenBankBT0879420.0BT087942.1 Zea mays full-length cDNA clone ZM_BFb0323H23 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004957289.11e-171PREDICTED: MADS-box transcription factor 8 isoform X2
SwissprotQ9SAR11e-159MADS8_ORYSJ; MADS-box transcription factor 8
TrEMBLK3ZWI11e-171K3ZWI1_SETIT; Uncharacterized protein
STRINGSi030960m1e-169(Setaria italica)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G24260.18e-94MIKC_MADS family protein